PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_4970V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 486aa    MW: 54016.3 Da    PI: 6.6692
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_4970V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.5e-181865148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed++lv +++++G g+W++ + + g+ R++k+c++rw +yl
  Pp3c1_4970V3.2.p 18 KGPWTPDEDQKLVAYIQKHGHGSWRSLPLHAGLQRCGKSCRLRWTNYL 65
                      79********************************************97 PP

2Myb_DNA-binding57.33.5e-1871116148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rgr+++eEd+ +v++++ lG++ W++Ia++++ +Rt++++k++w+++l
  Pp3c1_4970V3.2.p  71 RGRFSQEEDQMIVHLHAILGNR-WSAIASHLP-RRTDNEIKNYWNTHL 116
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-241068IPR009057Homeodomain-like
PROSITE profilePS5129418.5141365IPR017930Myb domain
SuperFamilySSF466893.67E-3115112IPR009057Homeodomain-like
SMARTSM007171.4E-131767IPR001005SANT/Myb domain
PfamPF002493.4E-161865IPR001005SANT/Myb domain
CDDcd001671.64E-112065No hitNo description
PROSITE profilePS5129427.29466120IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2769120IPR009057Homeodomain-like
SMARTSM007175.8E-1870118IPR001005SANT/Myb domain
PfamPF002493.1E-1671116IPR001005SANT/Myb domain
CDDcd001672.13E-1373116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MTRAPVSSAN EKDASLKKGP WTPDEDQKLV AYIQKHGHGS WRSLPLHAGL QRCGKSCRLR  60
WTNYLRPDIK RGRFSQEEDQ MIVHLHAILG NRWSAIASHL PRRTDNEIKN YWNTHLRKRL  120
LQMGIDPVTH KSTTAEELIL DNILPGLKPV VSSNLSHMSQ WEIARAEAEA RLSRQSSLNS  180
SSNLQHSHQD FNLNTKTTPY QGASTNFMST WKARVAETLR PDFGTVELDK VPANPVNLQA  240
FFQDWESLQA PQVLAKPFSE YNCIDCPDLS SGAASEVVSP QYSCEGSQCT MPGSSTIFPT  300
PAQINERQFV SQCDFFSSPR IDLKSRLSIG PSTMFPLSRM NSNSDSQSLS AADSNLNYSG  360
ACADTDNQFS PTSTLHAPDH DSSYTNSPCG SSNSGSECFD LLEQTFPLVN QNNIIKPSRS  420
NIVFPSGQTF WSRQQVAMMD GFQLDSYFLP ELELASLKPQ SFNVGSTAPI LHQVEVPNDI  480
SISHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-30161205108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001751220.11e-178predicted protein, partial
SwissprotP800741e-115MYB1_PHYPA; Myb-related protein Pp1 (Fragment)
TrEMBLA9RAV41e-178A9RAV4_PHYPA; Uncharacterized protein (Fragment)
STRINGPP1S45_150V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.12e-76myb domain protein 106